General Information

  • ID:  hor001983
  • Uniprot ID:  P06883
  • Protein name:  Oxyntomodulin
  • Gene name:  Gcg
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  Glucagon release is stimulated by hypoglycemia and inhibited by hyperglycemia, insulin, and somatostatin. GLP-1 and GLP-2 are induced in response to nutrient ingestion.|Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntom
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031769 glucagon receptor binding; GO:0042802 identical protein binding; GO:0048018 receptor ligand activity
  • GO BP:  GO:0006094 gluconeogenesis; GO:0006109 regulation of carbohydrate metabolic process; GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0010737 protein kinase A signaling; GO:0010800 positive regulation of peptidyl-threonine phosphorylation; GO:0014823 response to activity; GO:0019216 regulation of lipid metabolic process; GO:0032099 negative regulation of appetite; GO:0033138 positive regulation of peptidyl-serine phosphorylation; GO:0035774 positive regulation of insulin secretion involved in cellular response to glucose stimulus; GO:0042593 glucose homeostasis; GO:0043066 negative regulation of apoptotic process; GO:0045722 positive regulation of gluconeogenesis; GO:0050796 regulation of insulin secretion; GO:0050896 response to stimulus; GO:0051571 obsolete positive regulation of histone H3-K4 methylation; GO:0070374 positive regulation of ERK1 and ERK2 cascade; GO:0071377 cellular response to glucagon stimulus; GO:0090280 positive regulation of calcium ion import; GO:1900118 negative regulation of execution phase of apoptosis; GO:1903576 response to L-arginine; GO:2001243 negative regulation of intrinsic apoptotic signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0005886 plasma membrane

Sequence Information

  • Sequence:  HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
  • Length:  37(53-89)
  • Propeptide:  MKTVYIVAGLFVMLVQGSWQHAPQDTEENARSFPASQTEPLEDPDQINEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIAEELGRRHADGSFSDEMNTILDNLATRDFINWLIQTKITDKK
  • Signal peptide:  MKTVYIVAGLFVMLVQGSWQ
  • Modification:  T2 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Significantly reduces food intake
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Gcgr
  • Target Unid:  P30082
  • IC50: NA
  • EC50: cAMP=1.5nM for mGCGR
  • ED50: NA
  • kd: NA
  • Half life: 1.7 hours; /6120 seconds ( PubMed ID: 19602537 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P06883-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001983_AF2.pdbhor001983_ESM.pdb

Physical Information

Mass: 509218 Formula: C192H295N61O60S
Absent amino acids: CEP Common amino acids: NRS
pI: 10.44 Basic residues: 7
Polar residues: 14 Hydrophobic residues: 9
Hydrophobicity: -123.78 Boman Index: -13237
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 44.86
Instability Index: 7343.24 Extinction Coefficient cystines: 8480
Absorbance 280nm: 235.56

Literature

  • PubMed ID:  7937770##19602537
  • Title:  Purification and sequence of rat oxyntomodulin.